PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G2380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 256aa    MW: 29309 Da    PI: 6.7787
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G2380genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-152572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv+  + +G  +W+++++  g++R++k+c++rw +yl
      Gh_A09G2380 25 KGPWTAEEDKKLVNFMRTHGYYCWRAVPKLAGLRRCGKSCRLRWTNYL 72
                     79********************************************97 PP

2Myb_DNA-binding51.62.2e-1683122647
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
      Gh_A09G2380  83 HDEEQLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 122
                      68***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.8E-221673IPR009057Homeodomain-like
PROSITE profilePS5129415.3012072IPR017930Myb domain
SuperFamilySSF466892.38E-2722119IPR009057Homeodomain-like
SMARTSM007175.0E-122474IPR001005SANT/Myb domain
PfamPF002492.5E-142572IPR001005SANT/Myb domain
CDDcd001674.87E-92772No hitNo description
PROSITE profilePS5129426.53873127IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-2474128IPR009057Homeodomain-like
SMARTSM007174.7E-1477125IPR001005SANT/Myb domain
PfamPF002491.5E-1483122IPR001005SANT/Myb domain
CDDcd001672.54E-1084123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MVGVDWCKMR GTGRQPCCDK LGVKKGPWTA EEDKKLVNFM RTHGYYCWRA VPKLAGLRRC  60
GKSCRLRWTN YLRPDLKRGL LNHDEEQLVI DLHARLGNRW SKIAARLPGR TDNEIKNHWN  120
THIKKKLIKM GIDPATHEPL QKPDTPENKP NLDPNQPENL SKSCAHEFSL PTGTDEWRSS  180
WESDDDPSIN LIWSEAFLHD LSENFHGTDS WWKEYSEIGT SSKEETCFSW LVGDAGDDDG  240
NLGFSGFSEI LGMNLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28251277108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.185230.0stem
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6517830.0EF651783.1 Gossypium hirsutum transcription factor TF1 (TF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012486460.11e-172PREDICTED: protein ODORANT1-like
SwissprotQ50EX65e-83ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0B0PKI00.0A0A0B0PKI0_G
STRINGPOPTR_0015s14600.14e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.14e-85myb domain protein 85